Results for cjc :

64 Products from 22 Companies.
Select to Inquiry Now Add to Basket
(21-22 out of 22)
Shopping Carts

Shopping Carts

CJC-01 Shopping cart 700X472X550mm 75L 20 kgs Qingdao Spark Logistics Appliance Co., Ltd. Wangtai Town, 266425, ...
See All Items(2) from Qingdao Spark Logistics Appliance Co.,Ltd. [China]

CJC1295

peptide name: CJC-1295 peptide sequence: Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 Molecular Weight: 3367.8 Purity: ...
Shanghai Hanhong Chemical Co., Ltd [China]
Select to Inquire Now Add to Basket
(21-22 out of 22)
1  2 

Refine Search
Category
Location
Group Products
Search Options

Show Premium Suppliers
Subscription
  • Notify me of new cjc info.