18v dc motor
jis b
lithium battery-18650
bathroom accessories
water jet propulsion
yamaha 450
wall sticker
sodium heparin
keychain
www.indiamart.com
big pony polo
3g gsm booster
high top nike
7 star replica handbags
expanded metal
pachira
steel rolling mills
coconut machine
printing machine
jis b
toner and inkjet cartridge
balsamo
kite wall sticker
16.5 rims ford
donut machine
q235 steel grades
coconut cutting
red bull hats
pvc electrical adhesive tape
industrial sewing machines
dual sim phone gsm cdma nokia
phone vibration motor
q235 steel
cheese head screw
pmp games download
genset
spf lumber
halal food
marc jacob watch
chemicals materials
polo perfume
5w led
nestle nan
5 gallon water bottle
hypoid bevel gears
hgh 177-191
small electrical appliances
nike high tops
fabric
springs din 17224

Post Your Buying Leads

Advanced Search

Results for cjc1295/ghrp :

9 Products from 6 Companies.

Select to

(1-6 out of 6)

CJC1295/Ghrp/Mgf /MT-2/PT-141(Competitive Price)

CJC1295/Ghrp/Mgf /MT-2/PT-141(Competitive Price)

GHRP-2 6.GHRP-6 7.CJC1295 8.MGF/peg-MGF 9.Octreotide Acetate 10.Oxytocin Acetate 11.Triptorelin Acetate ...

See All Items(2) from Lianyungang Yuntai Foreign Trade Co.,Ltd [China]

CJC1295,GHRP-6,Thymopentin,Substance P,Melanotan,,PTH1-34

CJC1295,GHRP-6,Thymopentin,Substance P,Melanotan,,PTH1-34

cjc1295,ghrp-6,Thymopentin,H-Arg-Lys-Asp-Val-Tyr-OH,Substance P,Melanotan,Beta-Amyloid1-42, Secretin,GHRH 1-44 ...

See All Items(2) from Xi'an Huachen Biotechnology Co., Ltd. [China]

GHRP-2 Acetate,GHRP-6 Acetate,CJC1295,Sermorelin Acetate,

GHRP-2 Acetate,GHRP-6 Acetate,CJC1295,Sermorelin Acetate,

Packing: plastic vial(dedicated for peptide packing) or glass vial, quantity according to customer's detail ...

Chengdu Kaijie Bio-pharmaceuticals. [China]

Steroids

GHRP-2 Acetate 158861-67-7 Boldenone 846-48-0 GHRP-6 Acetate 87616-84-0 Boldenone ...

Novete Bio-tech Co Ltd [Hong Kong]

Melanotan

GHRP-2 5mg/vial GHRP-6 5mg/vial Mgf : 1mg/vial or 2mg/vial CJC1295: 2mg/vial Tyr-HGH ...

See All Items(2) from KL Biotechnology Co.,Ltd [China]

CJC1295

peptide name: CJC-1295 peptide sequence: Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 Molecular Weight: 3367.8 Purity: ...

Shanghai Hanhong Chemical Co., Ltd [China]

Select to

(1-6 out of 6)

1

Refine Search

Category

Location

China (8)
Hong Kong (1)

Group Products

All Products
1 Product Per Company

Search Options

Show Premium Suppliers

Subscription

Notify me of new cjc1295/ghrp info.

Looking for cjc1295/ghrp ?

You’ve come to the right place. This page is your cjc1295/ghrp one-stop source for the competitive price and quality. If you have a difficulty finding a right supplier, please post your own buying leads for free in My EC21.

Get Listed

EC21 is the largest global B2B marketplace. Global cjc1295/ghrp buyers find suppliers here every day. If you are a manufacturer or supplier who want more international buyers, join EC21 for free now, and get your products listed here.