- Categories
- Other Pharmaceutical Ingredients (3)
- Drugs (2)
- Pharmaceutical Intermediates (2)
- Fitness & Body Building (1)
- Group Products
- All Products
- 1 Product Per Company
- Search Options
- Show Premium Suppliers
- Subscription
-
Trade Alert
Notify me of new ghrh 1 29 info. - RSS Feeds
- My Recent History
Community
ghrh 1 29
: 8 Products from 7 SuppliersSupplier Country
- China (7)
- United States (1)
-
Sermorelin (2mg/Vial / 10vial/Kit )
-
Place of origin: China
- sometimes called GRF 1-29, is a grow hormone releasing hormone analogue. It is a 29-amino acid polypeptide representing ...
-
[ Related Categories : Health & Medical, Pharmaceutical Chemicals, Other Pharmaceutical Ingredients ]
[ Related Keywords : Sermorelin, manufacturer, China Seller, hormone ]
- Powerlife Nutrition Co., Ltd
-
[Manufacturer]
China
- Contact Now
-
Sermorelin/ Semorelin
-
Place of origin: China
Min. Order: 10 vials
- Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2,, is a growth hormone ...
-
[ Related Categories : Health & Medical, Pharmaceutical Chemicals, Pharmaceutical Intermediates ]
[ Related Keywords : Semorelin, Sermorelin, GRF 1-29, GHRH ]
- Synprotech Co. Ltd.
-
[Manufacturer]
China
- Contact Now
-
Sermorelin,Ship Fast and Securiy To the World
-
Place of origin: China
Min. Order: 1kit/10vials
Price Condition: FOB Hongkong
- 1aa, IGF-1LR-3, IGF-1, rhGH, hgh,MT2, Product name:Sermorelin Specification:2mg*10vials/kit Description:is a grow ...
-
[ Related Categories : Sports & Entertainment, Sport Products, Fitness & Body Building ]
[ Related Keywords : Sermorelin, Hexarelins, peptides, MT2 ]
- TPP Health Supplement Inc.
-
[Manufacturer]
China
- Contact Now
-
Sermorelin,Human Growth Hormone,Blue Top
-
Place of origin: China
Min. Order: 1kit
- sometimes called GRF 1-29, is a growth hormone releasing hormone analogue. It is a 29-amino acid polypeptide ...
-
[ Related Categories : Health & Medical, Pharmaceutical Chemicals, Pharmaceutical Intermediates ]
[ Related Keywords : Sermorelin, Leuprorelin Acetate, GDF, HGH ]
- Biosuper Health Medicine Tech Co.,Ltd.
-
[Manufacturer]
China
- Contact Now
-
Sermorelin Blue Top HGH IGF-1 LR3
-
Place of origin: China
Min. Order: 10pcs
Price: USD 8
Price Condition: EXW SHEN ZHEN
- Sermorelin sometimes called GRF 1-29, is a grow hormone releasing hormone analogue. It is a 29-amino acid polypeptide ...
-
[ Related Categories : Health & Medical, Drugs ]
[ Related Keywords : Sermorelin, IGF-1 LR3, Blue Top HGH, GHRP ]
- Simmons International Trade Co.,Ltd
-
[Manufacturer]
China
- Contact Now
-
Sermorelin Acetate, Sermorelin,CAS No. 86168-78-7
-
Place of origin: China
- 1.0% 1.2% 0.6% 8 Acetate Content ≤ 15.0% 12.1% 9 Water Content (Karl Fischer) ≤ 5.0% 4.5% 10 Peptide ...
-
[ Related Categories : Health & Medical, Pharmaceutical Chemicals, Other Pharmaceutical Ingredients ]
[ Related Keywords : Sermorelin Acetate, Sermorelin, IGF-1, MGF ]
- Keogenica Bioscience Institute
-
[Manufacturer]
China
- Contact Now
-
CJC-1293
-
Place of origin: United States
- 1293 aides in the stimulation of the pituitary gland to increase productions of growth hormone. Sermorelin is a "growth ...
-
[ Related Categories : Health & Medical, Drugs ]
[ Related Keywords : CJC-1293 ]
- Matixa
-
[Manufacturer]
United States
- Contact Now
- Can’t find what you are looking for? Post your Buying Leads for FREE!
- Do you have ghrh 1 29 or other products of your own? Post your Products or Selling Leads for FREE!
- Receive a Trade Alert for ghrh 1 29 directly to your email.
Competitive ghrh 1 29 products from various ghrh 1 29 manufacturers and ghrh 1 29 suppliers are listed above, please select quality and cheap items for you.
- You may also be interested in :
- 1 Din Car Dvd
- Air Force 1
- Hms 1/2
- Hms 1 2
- 3 In 1
- 1/3 Sony Ccd
- Hms 1
- Ghrh 1 29 Suppliers :
- 1 Din Car Dvd Suppliers
- Air Force 1 Suppliers
- Hms 1/2 Suppliers
- Hms 1 2 Suppliers
- 3 In 1 Suppliers
- 1/3 Sony Ccd Suppliers
- Hms 1 Suppliers
- Ghrh 1 29 Manufacturers :
- 1 Din Car Dvd Manufacturers
- Air Force 1 Manufacturers
- Hms 1/2 Manufacturers
- Hms 1 2 Manufacturers
- 3 In 1 Manufacturers
- 1/3 Sony Ccd Manufacturers
- Hms 1 Manufacturers
- China Ghrh 1 29 :
- China 1 Din Car Dvd
- China Air Force 1
- China Hms 1/2
- China Hms 1 2
- China 3 In 1
- China 1/3 Sony Ccd
- China Hms 1
- Ghrh 1 29 Buyers :
- 1 Din Car Dvd Buyers
- Air Force 1 Buyers
- Hms 1/2 Buyers
- Hms 1 2 Buyers
- 3 In 1 Buyers
- 1/3 Sony Ccd Buyers
- Hms 1 Buyers
- Looking for ghrh 1 29 ?
- You’ve come to the right place. This page is your ghrh 1 29 one-stop source for the competitive price and quality. If you have post your Buying Leads for FREE now!
Sponsored Sites
- Get Listed
- EC21 is the largest global B2B marketplace. Global ghrh 1 29 buyers find suppliers here every day. If you are a manufacturer or supplier who want more international buyers, join EC21 for free now, and get your products listed here.