Search Advanced Search
Home > Buy Now >

New Products

14,947 New Products Found ( 2017/03/28~2017/03/25 )

Vitamin,Vitamin C,Vitamin D,Vitamin E

Vitamin,Vitamin C,Vitamin D,Vitamin E

Place of origin:China

Price Condition:FOB

Performance index: Property: white or light yellow particle Content (ascorbic acid C6H8O6): ≥97% Drying loss: ≤2% Total arsenic (as As, mg/kg): ≤3 Heavy metal (as Pb, mg/kg): ≤20 Fun ...
Strong Chemical Co., Ltd.

[Supplier]

China

Trade PRO Member since 2006

Contact Now

New Apples Ipads Pro 128gb 12.9

New Apples Ipads Pro 128gb 12.9

Place of origin:United States

Price Condition:FOB

Brand: Apple Storage Capacity: 128GB Type: Tablet Internet Connectivity: Wi-Fi Product Line: iPad Pro Contract: Without Contract Operating System: iOS Resolution: 2732 x 2048 Screen Size: 12.9" ...
Hongkong Xumei Electronics Co. Limited

[Supplier]

China

Trade PRO Member since 2006

Contact Now

CJC-1293 (Mod Grf [1-29])

CJC-1293 (Mod Grf [1-29])

Place of origin:China

Price Condition:FOB

CJC-1295 without DAC (CJC-1293), a 29-amino acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide analogue of GHRH with D-Ala, Gln, Ala, and Leu substitution ...
RC-S Co.,Ltd.

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

PEG-MGF,PEG,MGF,IGF,PEG-MGF (PEGylated Mechano Growth Factor)

PEG-MGF,PEG,MGF,IGF,PEG-MGF (PEGylated Mechano Growth Factor)

Place of origin:China

Price Condition:FOB

PEG-MGF Min. order: 1 kit(10vials) Specification: 2m/vial Trade Terms: FOB Payment Terms: T/T, Western Union, MoneyGram Original: China Packing: Standard / Customized Packaging Sequence:PEG-Tyr- ...
RC-S Co.,Ltd.

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

Warm Beanie Hat Wireless Smart Bluetooth Knit Cap Headphone Headset Speaker Mic Music

Warm Beanie Hat Wireless Smart Bluetooth Knit Cap Headphone Headset Speaker Mic Music

Place of origin:China

Price Condition:FOB

Version: Bluetooth V3.0 + EDR Frequency: 2.4026ghz-2.480ghz Transmission distance: 10 meters / 32.80ft MIC transmission distance: ≤1 m / 3.28ft Lithium-ion battery: 3.7v / 160ma Charging time ...
Hongkong Xumei Electronics Co. Limited

[Supplier]

China

Trade PRO Member since 2006

Contact Now

4-cec

4-cec

Place of origin:Hong Kong

Price Condition:FOB

Package: 1kg/Aluminum foil bag Application: Research purpose Production Capacity: 500 Kilogram/Month Storage: Kept in a cool,dry and ventilated place Payment: WESTERN UNION, T/T, MONEY GRAM ...
Strong Chemical Co., Ltd.

[Supplier]

China

Trade PRO Member since 2006

Contact Now

Wholesales Jintropin Suppliers, 10IU/Vial, HGH Manufacturers, Human Growth Hormone, for Human Sex En

Wholesales Jintropin Suppliers, 10IU/Vial, HGH Manufacturers, Human Growth Hormone, for Human Sex En

Place of origin:China

Price Condition:FOB

Contact information: Skype: Email: Whatsapp: Website: * Lose fat, gain muscle * Increase energy level * Increase immune function * Enhance sexual performance * Increase cardiac output * Improve ...
Donghua Chemical Co.,Ltd.

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

4cprc Powder,Cprc Crystal , Big Crystal ,4 Cec,

4cprc Powder,Cprc Crystal , Big Crystal ,4 Cec,

Place of origin:China

Min. Order:1g

Price:USD 1

Price Condition:FOB

ProName: 4-CPRC Appearance: White powder ,white crystal DeliveryTime: as soon as the order is confirmed PackAge: Aluminum foil bag,or according to your requirement Port: Shanghai port Producti ...
Donghua Chemical Co.,Ltd.

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

Dark Gray Quartz Stones

Dark Gray Quartz Stones

Place of origin:China

Price Condition:FOB China Port

Technology: Italian technology Maximum specification: 3200x1600x30mm Materail: Quartz stones with high hardness and abrasion resistance, made by mixing and compressing dark gray background and fine ...
Winler Industrial and Trading Co,.Ltd.

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

Bkebdpss,Bks-ebdps,Bks-epdps,Bkepdpss CAS 802286-83- 5

Bkebdpss,Bks-ebdps,Bks-epdps,Bkepdpss CAS 802286-83- 5

Place of origin:China

Min. Order:1g

Price:USD 10

Price Condition:FOB Guangdong

Product: Bks-ebdps CAS No.: 802286-83-5 Purity: 99.50% Description: brown block Packing: 1kg/aluminum foil bag Storage: Kept in a cool, dry and ventilated place. Usage: For research purpose We ...
Donghua Chemical Co.,Ltd.

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

4mpd

4mpd

Place of origin:China

Min. Order:5

Price:USD 1

Price Condition:FOB

ProName: 4mpd CasNo: 107-41-5 Appearance: white Application: for research DeliveryTime: 1-3days PackAge: 100gram 500gram 1kg Port: China ProductionCapacity: 100 Kilogram/Week Purity: 99.99% Storage: ...
Dalian Lichuang Trade Ltd

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

SDB-005 Powder, SDB005 Manufactory Supply

SDB-005 Powder, SDB005 Manufactory Supply

Place of origin:China

Price Condition:FOB

Product Name: SDB-005(5F-SDB-005) CAS: 99312-12-2 Appearance: White powder Purity: >99% Origin: China Application: For chemical research Formula: C23H21FN2O2 Molecular weight: 376.42 IUPAC:1- ...
Chang Qing Research Group Co.,Ltd

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

Mexedrones,Mexe,Mexe Powder and Crystal

Mexedrones,Mexe,Mexe Powder and Crystal

Place of origin:China

Price Condition:FOB

Product Name: MEXE Usage: apearance: white powder or crystal Place of Origin China with Super quality by reasonable price. Fast delivery by safe express way to all the country. Sample order are ...
Strong Chemical Co., Ltd.

[Supplier]

China

Trade PRO Member since 2006

Contact Now

Customized Color Authentic 100% Remy Human Hair Lace Frontals Raw Virgin Hair

Customized Color Authentic 100% Remy Human Hair Lace Frontals Raw Virgin Hair

Place of origin:China

Min. Order:10 Pack

Price Condition:FOB

PRODUCT INFORMATION Product Lace Frontal Hair Material 100% human hair Hair Color Natural color, other single color or T color is available Lace color Light, middle or dark brown Density 80%-180% or ...
Winler Industrial and Trading Co,.Ltd.

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

Vildagliptin,CAS NO.274901-16-5

Vildagliptin,CAS NO.274901-16-5

Place of origin:China

Min. Order:10g

Price Condition:FOB

Product Introduction: Product: : Vildagliptin CasNo: 274901-16-5 Molecular Formula: C17H25N3O2 Appearance: white powder Application: Pharmaceutical intermediates Package: aluminum foil bag or a ...
Alpine Technology Co.,Ltd

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

CJC-1295 with DAC   Supplier,CJC-1295 DAC,CJC-1295 Acetate,(2mg/5mg/10mg Per Vial),CJC1295

CJC-1295 with DAC Supplier,CJC-1295 DAC,CJC-1295 Acetate,(2mg/5mg/10mg Per Vial),CJC1295

Place of origin:China

Price Condition:FOB

Specification: 2mg /customized Package: 10 Vials/Kit Storage:2-8 degree centigrade refrigerator CJC-1295, also known as DAC: (Growth hormone Releasing Factor), is a syntheticanalogue of growth ho ...
Donghua Chemical Co.,Ltd.

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

Hot Sell Waterproof Cell Phone Cases with Plastic Lock,Mobile Phone PVC Waterproof Dry Bag

Hot Sell Waterproof Cell Phone Cases with Plastic Lock,Mobile Phone PVC Waterproof Dry Bag

Place of origin:China

Price Condition:FOB

we have all kinds of Waterproof Cell Phone Case for kinds of mobile phone, if you need, contact me ...
Hongkong Xumei Electronics Co. Limited

[Supplier]

China

Trade PRO Member since 2006

Contact Now

2'-Oxo-PCM (HCL) Powder 99.7% Purity in Stock

2'-Oxo-PCM (HCL) Powder 99.7% Purity in Stock

Place of origin:China

Min. Order:100g

Price:USD 2500

Price Condition:FOB Shanghai,Shenzhen,Hongkong

2'-Oxo-PCM (HCL) CAS: 4631-27-0 Formula: C13H17NO Molecular weight: 203.260 Compound purity: > 99.7% Appearance: Powder IUPAC: 2-Phenyl-2-(methylamino)cyclohexanone Synonyms: Deschloroketamine, 2 ...
Iamcor Biotech Co.,Ltd

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

THPVP TH-PVP Big Crystal Crystal

THPVP TH-PVP Big Crystal Crystal

Place of origin:China

Price Condition:FOB

1.commodity:TH-PVP 2.CAS NO.:263409-96-7 3.CB NO.:CB53049742 4.MF:C11H17Cl2FN2 5.FW:267.17 6.apperance:white powder 7.color:brown,black,red,white 8.package:in aluminum foil bags 9.delivery:EM ...
Donghua Chemical Co.,Ltd.

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

Tamoxifen(Nolvadex)

Tamoxifen(Nolvadex)

Place of origin:China

Price Condition:FOB

ProName: High Purity Tamoxifen(Nolvadex) CasNo: 10540-29-1 Appearance: white crystall powder. Application: Medicine,Bodybuilding,Raw material... DeliveryTime: 3-5days PackAge: As your require Port: H ...
JinZhengDa Biological Technology Co.,Ltd.

[Manufacturer]

China

Trade PRO Member since 2006

Contact Now

(1-20 out of 14,947)

Page 1 of 74812345678910Next  Last
Go to Page Go
Buyer Tools
How to Buy?
Post Buying Leads
Trade Alert
Credit Report

Get Listed
EC21 is the largest global B2B marketplace. Global buyers find suppliers here every day. If you are a manufacturer or supplier who want more international buyers, join EC21 for free now, and get your products listed here.

Browse: Manufacturer Directory Countries China India Korea Premium Suppliers Community Site Map

About EC21 Contact Us Terms & Conditions Report Item Online Trading Risks Product Listing Policy

中文 繁體 한국어 日本語 Español Русский Français Deutsch

Copyright (c)1997-2017 EC21 Inc. All Rights Reserved. EC21 in KoreanChinese

Business Registry Number: 120-86-03931

Inquiry Basket