Search Advanced Search
Home > Buy Now >

New Products

26,256 New Products Found ( 2014/04/25~2014/04/22 )

Cardan Shaft,Propeller Shaft,Drive Shaft,Pro Shaft

Cardan Shaft,Propeller Shaft,Drive Shaft,Pro Shaft

Cardan Shaft, drive Shaft, Propeller Shaft, Shaft, Cardanshaft, Pro shaft, Driveshaft, Automatic Transmission, Shafts, Propeller shafts, agricultural drive shaft, auto drive shaft, transmission shaft ...
Zhejiang Succeed Auto Parts Co.,Ltd.

[Manufacturer]

China

Trade OK Member since 2012

Contact Now

Testosterone Enanthate 250mg/Ml*10ml/Bottle

Testosterone Enanthate 250mg/Ml*10ml/Bottle

Place of origin:China

Finished products       Melanotan 1 121062-08-6 US$16/vial 10mg/vial US$1400/100vials Melanotan 2 121062-08-6 US$16/vial 10mg/vial US$1300/100vials IGF LR 3 -1 67763-96-6 US$32/vial 1mg/vial US ...
Powerlife Natural Co., Ltd

[Manufacturer]

China

Trade PRO Member since 2012 This company has been verified.

Contact Now

Medical Equipment Full Digital Portable Ultrasound Scanner WHYC30P

Medical Equipment Full Digital Portable Ultrasound Scanner WHYC30P

Place of origin:China

Min. Order:1pcs

Price Condition:FOB

Details MODEL WHYC30P SPECS Probe EL1-3/7.5 MHz Endo-Rectal probe L1-3/7.5MHz Linear probe C1-8/20R/5.0MHz Micro-convex probe C1-7/60R/3.5MHz convex array probe EC1-2/13R/6.5MHz Transvaginal probe De ...
Poweam Medical Systems Co., Ltd

[Manufacturer]

China

Trade OK Member since 2012

Contact Now

Hot in USA Sex Product Libigrow Pill

Hot in USA Sex Product Libigrow Pill

Place of origin:China

Min. Order:10 boxes

Price Condition:FOB

Hot in USA Sex Product Libigrow Pill. Libigrow pill, sex products pill, hot selling products We manufacture kinds of sex enhancement and wholesale all kinds of sex medicine.We offer these prodcut wit ...
Sichuan Herbal Biotechnology Co.,Ltd

[Supplier]

China

Trade OK Member since 2012

Contact Now

Boldenones Undecylenate / CAS NO.:3103-34-9

Boldenones Undecylenate / CAS NO.:3103-34-9

Place of origin:China

Min. Order:100g

Price:USD 1

Price Condition:FOB

1.product details: Boldenones Undecylenate CAS NO.:13103-34-9 Molecular Formula: C30H44O3 Molecular Weight: 452.67 Chemical Name: 1,4-androstadien-17beta-ol-3-one undeclylenate Description: Pale yell ...
Landmark Nutraceuticals Co.,Limited

[Manufacturer]

China

Trade PRO Member since 2012

Contact Now

Lose Weight Coffee - Slimming Easily [03]

Lose Weight Coffee - Slimming Easily [03]

Place of origin:China

Min. Order:50 boxes

Price:USD 3.2

Price Condition:FOB shenzhen

Easy to be slim by drink one bag lose weight coffee a day! Product Description: It is made from traditional coffee mixed with hunger-oblivion grass, griffonia simplicifolia,natural plants extracts ...
Kunming Global Trade Co., Ltd

[Manufacturer]

China

Trade PRO Member since 2012

Contact Now

Oxygen Sensor,Auto Sensor

Oxygen Sensor,Auto Sensor

oxygen sensor, Auto sensor, crankshaft position sensor, air pressure sensor, air flow sensor, ABS sensor, wheel speed sensor, fuel tank level sensor, oil level sensor, water level sensor, brake press ...
Zhejiang Succeed Auto Parts Co.,Ltd.

[Manufacturer]

China

Trade OK Member since 2012

Contact Now

Auto Sensor,Auto Switch,Auto Parts

Auto Sensor,Auto Switch,Auto Parts

Auto sensor, oxygen sensor, crankshaft position sensor, air pressure sensor, air flow sensor, ABS sensor, wheel speed sensor, fuel tank level sensor, oil level sensor, water level sensor, brake press ...
Zhejiang Succeed Auto Parts Co.,Ltd.

[Manufacturer]

China

Trade OK Member since 2012

Contact Now

Fuel Sensor,Fuel Tank Level Sensor,Truck Sensor

Fuel Sensor,Fuel Tank Level Sensor,Truck Sensor

fuel sensor, Fuel Tank Level Sensor, Crankshaft Position Sensor, Air Pressure Sensor, Air Flow Sensor, truck Sensor, Auto Sensor, Oxygen Sensor, Oil Level Sensor, Water Level Sensor, Brake Pressure S ...
Zhejiang Succeed Auto Parts Co.,Ltd.

[Manufacturer]

China

Trade OK Member since 2012

Contact Now

Siren Horn, Alarm Speaker,Loudspeaker for Police Vehicle

Siren Horn, Alarm Speaker,Loudspeaker for Police Vehicle

Place of origin:China

Auto Horn, Loud speaker, Horn, Alarm Speaker, Siren Horn, Electronic Horn, Air Horn, Car Horn, Back Horn, Horn Speaker, Car Speaker, Stebel Nautilus Horn, Alarm, Speaker, Auto Speaker, Electronic Air ...
Zhejiang Succeed Auto Parts Co.,Ltd.

[Manufacturer]

China

Trade OK Member since 2012

Contact Now

Styrene Butadiene Rubber/SBR

Styrene Butadiene Rubber/SBR

Place of origin:Korea

Price Condition:FOB

Product details: Name: SBR1502 Model number: 1502 Place of origin: Korea Brand Name: KUMHO Packaging & Delivery: Packaging Detail: 35kg/bag Delivery Detail: within 15 days after payment Payment terms ...
shijiazhuang ochuang rubber co.,ltd

[Manufacturer]

China

Trade PRO Member since 2012

Contact Now

Oxalic Acid CAS:144-62-7

Oxalic Acid CAS:144-62-7

Place of origin:China

Price Condition:FOB

English name: Oxalic acid CAS no. : 144-62-7 Molecular formula: C2O4 Molecular weight: 88.0201 Content; 99.6% Properties: white crystalline granular, no smell. 150 ~ 160 ℃ sublimation. In the ...
Fuxing Technology Co., Ltd

[Supplier]

China

Trade PRO Member since 2012

Contact Now

Sulfur Coated Urea(SCU)

Sulfur Coated Urea(SCU)

Place of origin:China

Min. Order:22tons

Price:USD 420

Price Condition:FOB Xingang

Specifications SCU TYPE I Nitrogen :37% min. S:10%min Biuret :1.5% max Moisture :1.0% max Size: 1.00-4.75mm or 3.35-5.56 90% min. SCU(SULFUR COATED UREA) Type I NITROGEN:37% MIN INITIAL RELEASE OF A ...
Tianyi Metal&Chem Industrial Co., Ltd.

[Manufacturer]

China

Trade PRO Member since 2012

Contact Now

Used LIEBHERR Truck Crane LTM1030

Used LIEBHERR Truck Crane LTM1030

Place of origin:Germany

Min. Order:1

Price Condition:FOB

Product: LIEBHERR Truck Crane Model: LTM1030 Used japan construction machinery Carrier Engine Make: Mercedes-Benz Model: OM906 LA Gross Power: 278 hp/207.3 kw Carrier Fuel Capacity: 79.3 gal/300 ...
Union Machinery Co.,Ltd

[Manufacturer]

China

Trade PRO Member since 2012

Contact Now

Sermorelin/ Semorelin

Sermorelin/ Semorelin

Place of origin:China

Min. Order:10 vials

Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2,, is a growth hormone releasing hormone analogue. It is a 29-amino acid polypeptide representing the 1-29 fra ...
Synprotech Co. Ltd.

[Manufacturer]

China

Trade PRO Member since 2012

Contact Now

TB500 / TB-500 (Thymosin Beta 4 )

TB500 / TB-500 (Thymosin Beta 4 )

Place of origin:China

Min. Order:10 vials

Thymosin Beta-4 is a unique peptide that was first discovered in the thymus, a gland in the human body. Since that initial discovery, however, thymosins of all sorts have been found present in all di ...
Synprotech Co. Ltd.

[Manufacturer]

China

Trade PRO Member since 2012

Contact Now

Melamine Sponge

Melamine Sponge

Place of origin:Korea

Min. Order:Negotiable

Price Condition:FOB

Material : 1) Pure melamine 2) Melamine + sponge 3) Melamine + Nylon Color : yellow, blue, pink etc Packing : Any packing method you choose : Bulk, Polybag, Paper band, Vinyl band. Remark : OEM and O ...
Shinil Co.,Ltd.

[Manufacturer]

Korea

Trade PRO Member since 2012

Contact Now

Clomiphene (Clomid) 50mg/Grain 20grain/Bottle

Clomiphene (Clomid) 50mg/Grain 20grain/Bottle

Place of origin:China

Finished products       Melanotan 1 121062-08-6 US$16/vial 10mg/vial US$1400/100vials Melanotan 2 121062-08-6 US$16/vial 10mg/vial US$1300/100vials IGF LR 3 -1 67763-96-6 US$32/vial 1mg/vial US ...
Powerlife Natural Co., Ltd

[Manufacturer]

China

Trade PRO Member since 2012 This company has been verified.

Contact Now

Sodium Sulphate 99%,Sodium Sulphate Anhydrous

Sodium Sulphate 99%,Sodium Sulphate Anhydrous

Place of origin:China

Min. Order:1fcl

Sodium Sulphate Anhydrous Purity: 99% Detergent grade: PH 9-11 Neutral Grade: Ph 6-8 Uses: used as filler of detergent, the making of sodium sulphide, water glass, or used in papermaking, glass, dye ...
Hutong Global Co.,Ltd

[Manufacturer]

China

Trade OK Member since 2012

Contact Now

JWH122

JWH122

Place of origin:China

Min. Order:10g

Price:USD 2200

Price Condition:FOB anywhere

best packing , shipping and will offer you our most competitive price . keep you good quality . hope you can come back to us . welcome you inquiry to us . ...
Shannxi Kaizheng Trading Co.,Ltd.

[Supplier]

China

Trade PRO Member since 2012

Contact Now

(1-20 out of 26,256)

Page 1 of 131312345678910Next  Last
Go to Page Go
Buyer Tools
How to Buy?
Post Buying Leads
Trade Alert
Credit Report


Get Listed
EC21 is the largest global B2B marketplace. Global buyers find suppliers here every day. If you are a manufacturer or supplier who want more international buyers, join EC21 for free now, and get your products listed here.

Browse: Manufacturer Directory Countries China India Korea Premium Suppliers Community Site Map

About EC21 Contact Us Terms & Conditions Report Item Online Trading Risks Product Listing Policy

中文 繁體 한국어 日本語 Español Русский Français Deutsch

Copyright (c)1997-2014 EC21 Inc. All Rights Reserved. EC21 in KoreanChinese

Business Registry Number: 120-86-03931

Inquiry Basket